Dactylosporangium vinaceum: Dvina_17830 Help Entry Dvina_17830       CDS       T07478                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism dvc  Dactylosporangium vinaceum Pathway dvc00253   Tetracycline biosynthesis dvc01056   Biosynthesis of type II polyketide backbone dvc01100   Metabolic pathways dvc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvc00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     Dvina_17830    00253 Tetracycline biosynthesis     Dvina_17830  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:dvc01004]     Dvina_17830    01008 Polyketide biosynthesis proteins [BR:dvc01008]     Dvina_17830 Lipid biosynthesis proteins [BR:dvc01004]  Polyketide synthase   Component type    Dvina_17830 Polyketide biosynthesis proteins [BR:dvc01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      Dvina_17830     Nonaketide PKS      Dvina_17830     Decaketide PKS      Dvina_17830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4423 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UAB99753 LinkDB All DBs Position 3968725..3969003 Genome browser AA seq 92 aa AA seqDB search MQQHFDIADLQQVVASCVGVTDVGVISVETLDESFADLGVDSLARYEVATRLQDTLTVTI SDDDIERATTPRLMLALVNERLSGLAQQGSGT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcacttcgacatcgccgacctgcagcaggtcgtggccagctgcgtcggcgtc accgacgtcggcgtcatcagtgtcgagacactcgacgaatcgttcgcggacctcggcgtc gactcgctcgcccgctacgaggtggccacccggctgcaggacaccctgacggtgacaatc tccgacgatgacatcgagcgggccaccacaccgcggctgatgctcgccctcgtcaacgag cgcctcagcggccttgcccagcagggctccgggacatga

DBGET integrated database retrieval system