KEGG   Dactylosporangium vinaceum: Dvina_37050
Entry
Dvina_37050       CDS       T07478                                 
Name
(GenBank) M56 family metallopeptidase
  KO
K02172  bla regulator protein blaR1
Organism
dvc  Dactylosporangium vinaceum
Pathway
dvc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dvc00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Dvina_37050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dvc01002]
    Dvina_37050
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:dvc01504]
    Dvina_37050
Peptidases and inhibitors [BR:dvc01002]
 Metallo peptidases
  Family M56
   Dvina_37050
Antimicrobial resistance genes [BR:dvc01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    Dvina_37050
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 DUF6866_C
Other DBs
NCBI-ProteinID: UAB93777
LinkDB
Position
complement(8244209..8245144)
AA seq 311 aa
MSPLLLVAFGTALALVAAPRLAAAGWVARSPRLGVVAWLALSAGVLLSALLAGLTLVLYW
DCAHDLAAGAWHFCLDALLGRQDRRARAIALAGLAALVLLGARLGLSTARLYTTHRSLRS
RLRLLVRAAGTSHAVPGATVVTHPEPAAYLVPGPRLPGRPADIVITSAAVDRLQAEELSA
VLAHERGHHEGRHFEATRWMRMLAQAFPGAVCFRLGARQVDRLVEMCADDTAARTAERLD
LARALVALAGSPGPAPDLALDGGDALERMHRLLDPPRPLSLLQRAAVATLCAGGVTTPPL
LAVLERTFLVL
NT seq 936 nt   +upstreamnt  +downstreamnt
atgagcccgctgctgctcgtcgcgttcggcaccgcgctcgccctggtcgcggcgccccgg
ctggccgcggcgggctgggtggcccgctcgccccggctcggcgttgtcgcctggctggcc
ctgagcgcgggcgtgctgctgtcggcgctgctggccgggctgacgctggtgctgtactgg
gactgcgcccacgacctcgcggccggcgcctggcacttctgcctcgacgcgctcctgggc
cgccaggaccgccgggcccgggccatcgcgctggccggcctggccgcactggtgctgctc
ggcgcccggctgggcctgagcaccgcccggctctacacgacgcaccgctcgctgcgcagc
cggctgcggctgctggtgcgggcggccgggacgagccacgcggtgcccggcgcgacggtg
gtgacccacccggagccggcggcctacctggtccccggcccgcggctgcccggccgcccg
gccgacatcgtcatcacgtcggccgccgtggaccgtctgcaggccgaggagctttcagcg
gtactcgcccacgagcgcgggcaccacgaaggccgccatttcgaggcgacccggtggatg
cgcatgctcgcgcaggcgttcccgggggccgtgtgcttccggctgggcgcgcgccaggtg
gaccgcctggtcgagatgtgcgccgacgacaccgcggcccgcaccgccgagcgcctcgac
ctcgcccgcgcgctcgtcgcgctggccggctcgccgggcccggcgccggacctggccctc
gacggcggcgacgccctcgagcgcatgcaccgcctgctggacccgccgcggcccctgtcg
ctgctgcagcgggccgccgtcgccacgctctgtgcgggcggggtgacgactccgccgctg
ctggcggtactggagcggacgttcctggttttgtag

DBGET integrated database retrieval system