Dactylosporangium vinaceum: Dvina_53865
Help
Entry
Dvina_53865 CDS
T07478
Symbol
yidC
Name
(GenBank) membrane protein insertase YidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
dvc
Dactylosporangium vinaceum
Pathway
dvc02024
Quorum sensing
dvc03060
Protein export
dvc03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
dvc00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
Dvina_53865 (yidC)
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
Dvina_53865 (yidC)
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
Dvina_53865 (yidC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
dvc03029
]
Dvina_53865 (yidC)
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
dvc02044
]
Dvina_53865 (yidC)
Mitochondrial biogenesis [BR:
dvc03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
Dvina_53865 (yidC)
Secretion system [BR:
dvc02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
Dvina_53865 (yidC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
60KD_IMP
MFS_Mycoplasma
DUF3382
SfLAP
DUF2192
Tup_N
DUF6377
Motif
Other DBs
NCBI-ProteinID:
UAC02473
LinkDB
All DBs
Position
complement(11957388..11958464)
Genome browser
AA seq
358 aa
AA seq
DB search
MAGIYWLISKVMLFWHTVWDSILPDHRVLSTNWQWVLAIVFLVITVRVVLFPIFVKQIKS
QRAMQAIQPKMKELQEKHKGDRETLQKEVMKLYQEEKVNPLMGCLPMFLQIPVFIGLLHV
LRHLRPGQSEHQQTLYGWTVKEFESAVDARLFDAPIVAKFSSSAADLLKIDASSTAVKIV
AAILVALMITTTYLTQRQMIKKTGWNSDPQQRMIQKFMLYGIPFFTLTSGWYFPIGVIIY
WVTNNAITLGQQYWVLHKYPPPANANTTTTPFKAGGKQTADAKQPSGFGALFSKAREQAA
AQQRTNGKGGPVKATGVKANGAKANGAAPEPAGPSRAPKPGAKPINPKKGGAAKRQSG
NT seq
1077 nt
NT seq
+upstream
nt +downstream
nt
atggccgggatctactggctgatctcgaaggtgatgctgttctggcacaccgtctgggat
tcgatcctgccggaccaccgggtgctgagcaccaactggcagtgggtgctcgcgattgtc
ttcctcgtgatcaccgtccgggtcgtgctcttcccgatcttcgtcaagcagatcaagtcg
cagcgcgccatgcaggcgatccagccgaagatgaaggagctgcaggagaagcacaagggc
gaccgggagaccctccagaaggaggtcatgaagctgtaccaggaggagaaggtcaacccg
ctcatgggctgccttccgatgttcctccagatcccggtcttcatcggcctcctgcacgtg
ctgcgccacctccgccccggccagtccgagcaccagcagacgctctacggctggacggtc
aaggagttcgagagcgccgtcgacgctcgcctcttcgacgccccgatcgtcgccaagttc
agcagcagcgcggccgacctgctgaagatcgacgcgagctcgaccgcggtcaagattgtc
gccgccatcctggtcgcgctgatgatcacaacgacctacctgacccagcgccagatgatc
aagaagacgggctggaactccgacccgcagcagcgcatgatccagaagttcatgctctac
ggcatcccgttcttcacgctgacctcgggctggtacttccctatcggcgtcatcatctac
tgggtcaccaacaacgccatcacgctcggccagcagtactgggtcctgcacaagtacccg
ccgccggcgaacgcgaacaccaccaccacgccgttcaaggccggaggcaagcagaccgcc
gacgccaagcagcccagcggcttcggcgcgctgttcagcaaggctcgcgagcaggccgcc
gcccagcagcggaccaacggcaagggcggccccgtgaaggcgaccggcgtcaaagccaac
ggcgccaaggcgaacggcgccgctccggagccggccggcccgtcccgcgcaccgaagccg
ggcgccaagccgatcaacccgaagaagggtggcgccgcgaagcggcagtcgggttga
DBGET
integrated database retrieval system