Desulfuromonas versatilis: DESUT3_02510 Help Entry DESUT3_02510      CDS       T07752                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dve  Desulfuromonas versatilis Pathway dve01100   Metabolic pathways dve01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dve00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DESUT3_02510 (acpP_1)    00074 Mycolic acid biosynthesis     DESUT3_02510 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DESUT3_02510 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BCR03182 LinkDB All DBs Position 302203..302469 Genome browser AA seq 88 aa AA seqDB search MTDQEIIDLINSSLAEEFELDPADMAPEANIYEDLGLDSLDTVDMVVVLEGAFRFKIREE DGIREIRTLGDIHRFVIDKKRAAELKSA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgactgaccaagagatcatcgacctgatcaacagctcgctggccgaggagttcgaactc gaccccgccgacatggccccggaggccaacatctacgaggacctcggcctcgacagcctg gacaccgtcgacatggtggtggtgctcgagggggccttccgcttcaagatccgcgaagag gacggcatccgcgagatccgcaccctgggcgacatccaccgcttcgtgatcgacaagaag cgcgccgcggagctgaaatcggcctga

DBGET integrated database retrieval system