Nitratidesulfovibrio vulgaris RCH1: Deval_1367 Help Entry Deval_1367        CDS       T02064                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dvg  Nitratidesulfovibrio vulgaris RCH1 Pathway dvg00020   Citrate cycle (TCA cycle) dvg00720   Other carbon fixation pathways dvg01100   Metabolic pathways dvg01110   Biosynthesis of secondary metabolites dvg01120   Microbial metabolism in diverse environments dvg01200   Carbon metabolism dvg01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dvg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Deval_1367   09102 Energy metabolism    00720 Other carbon fixation pathways     Deval_1367 Enzymes [BR:dvg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Deval_1367 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_21 Fer4_9 Fer4_2 Fer4_4 Fer4_16 Fer4_6 Fer4_8 Fer4_3 LdpA_Fe-S-bd Fer4_13 Fer4_15 Fer4_17 Motif Other DBs NCBI-ProteinID:  ADP86523 LinkDB All DBs Position complement(1565309..1565581) Genome browser AA seq 90 aa AA seqDB search MAKISKGQTLVCVYPDWCKGCGLCVAFCPGKVLELNPLGKAEVAHPEECINCGFCELHCP DFAIAIKPKASGQSCPSHGKAEPNPNSDEY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggccaaaatcagcaaagggcagaccctcgtctgcgtgtacccggactggtgcaagggc tgcggtctctgcgtggccttctgcccgggcaaggttctcgaactcaacccccttggcaag gcggaggtggcgcaccccgaagaatgcatcaactgcggcttctgcgaattgcactgtccc gatttcgccatagccatcaagcccaaggccagcggacagtcctgcccttcacatggcaag gccgaacccaaccccaactccgacgagtactga

DBGET integrated database retrieval system