Drosophila virilis: 138911330 Help Entry 138911330         CDS       T01066                                  Symbol azot Name (RefSeq) calmodulin   KO K02183   calmodulin Organism dvi  Drosophila virilis Pathway dvi04070   Phosphatidylinositol signaling system dvi04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     138911330 (azot)  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     138911330 (azot)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dvi01009]     138911330 (azot)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dvi04131]     138911330 (azot)    03036 Chromosome and associated proteins [BR:dvi03036]     138911330 (azot)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dvi04147]     138911330 (azot) Protein phosphatases and associated proteins [BR:dvi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      138911330 (azot) Membrane trafficking [BR:dvi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     138911330 (azot) Chromosome and associated proteins [BR:dvi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      138911330 (azot) Exosome [BR:dvi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    138911330 (azot) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EH AIF-1 EF_EFCAB10_C SPARC_Ca_bdg DUF5580_M SurA_N_2 SurA_N_3 UPF0154 TerB Motif Other DBs NCBI-GeneID:  138911330 NCBI-ProteinID:  XP_070065853 LinkDB All DBs Position 5:3456079..3457020 Genome browser AA seq 151 aa AA seqDB search MEELTKNQLAVFQELFNIIDVEQDGSVTYKELSVVLRALGGNLPDGVIHDMINESDEDGN GSLDFSEFTKILLRKMSDTDRPEDLRETFRLYDKDNNGFISAAELRTIFTSIGMKVSDEE IEDMIRDADLDGDGVLLYDEFANMMTSLDEN NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggaggaattgacaaagaaccaattggccgtttttcaagagttgttcaacataattgac gttgaacaggatggcagcgttacctacaaggagctgagtgttgtcctgcgcgcattgggc ggcaacctgcccgatggggttatccatgacatgatcaatgagtcggacgaggatggcaac ggttctctggactttagcgaattcactaagattctgttacgcaaaatgtccgatacggat cgacccgaggatctgcgcgagacatttaggttgtacgacaaggacaataatggcttcatc tcggcagctgaattgcgcacaatttttacatcaattggcatgaaagtgtccgatgaggag attgaggacatgattcgcgatgcggacctagacggcgatggggttttattgtatgacgaa ttcgccaacatgatgacctcattggacgagaattga

DBGET integrated database retrieval system