Drosophila virilis: 6622165 Help Entry 6622165           CDS       T01066                                  Symbol Rac1 Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dvi  Drosophila virilis Pathway dvi04013   MAPK signaling pathway - fly dvi04145   Phagosome dvi04148   Efferocytosis dvi04310   Wnt signaling pathway dvi04620   Toll-like receptor signaling pathway dvi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     6622165 (Rac1)    04310 Wnt signaling pathway     6622165 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     6622165 (Rac1)    04148 Efferocytosis     6622165 (Rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     6622165 (Rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     6622165 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dvi04131]     6622165 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dvi04147]     6622165 (Rac1)    04031 GTP-binding proteins [BR:dvi04031]     6622165 (Rac1) Membrane trafficking [BR:dvi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     6622165 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     6622165 (Rac1)   Macropinocytosis    Ras GTPases     6622165 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     6622165 (Rac1) Exosome [BR:dvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6622165 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    6622165 (Rac1)   Exosomal proteins of colorectal cancer cells    6622165 (Rac1)   Exosomal proteins of bladder cancer cells    6622165 (Rac1) GTP-binding proteins [BR:dvi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     6622165 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  6622165 NCBI-ProteinID:  XP_002047042 UniProt:  B4LG76 LinkDB All DBs Position 3:10483940..10487601 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR DDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPV LQPKSKRKCALL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgtgtcgtcgtgggtgacggtgctgtgggtaagacgtgcctgctc atcagctacacgacaaatgcgtttcccggcgaatatatacccaccgtatttgacaattac tccgcgaatgtgatggtcgatgcgaaacccatcaatttgggactgtgggatacggccggt caggaggattatgatcgtttgcgtccattatcgtatccacagaccgatgtctttctcatt tgcttctcgctggtcaatccggcctcgtttgagaacgtgcgagccaaatggtatccggag gtgcgccatcattgccccagcacgcccatcattttggtgggcaccaagctggatttgcgc gacgacaagaacacgattgagaagctgcgcgacaagaaactggcgccgatcacataccca cagggtctggccatggccaaggagattggcgctgttaaatatttggagtgctcggcgcta acgcaaaagggcctaaagaccgtcttcgatgaggctattagatcggtgctttgtcccgtt ctgcagcctaaatccaagcgcaaatgcgctctgctctaa

DBGET integrated database retrieval system