Drosophila virilis: 6630774 Help Entry 6630774           CDS       T01066                                  Name (RefSeq) ras-related protein Rab7   KO K07897   Ras-related protein Rab-7A Organism dvi  Drosophila virilis Pathway dvi04137   Mitophagy - animal dvi04140   Autophagy - animal dvi04144   Endocytosis dvi04145   Phagosome dvi04148   Efferocytosis Brite KEGG Orthology (KO) [BR:dvi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6630774    04145 Phagosome     6630774    04140 Autophagy - animal     6630774    04137 Mitophagy - animal     6630774    04148 Efferocytosis     6630774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dvi04131]     6630774   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dvi04147]     6630774    04031 GTP-binding proteins [BR:dvi04031]     6630774 Membrane trafficking [BR:dvi04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     6630774 Exosome [BR:dvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6630774   Exosomal proteins of other body fluids (saliva and urine)    6630774   Exosomal proteins of colorectal cancer cells    6630774   Exosomal proteins of bladder cancer cells    6630774 GTP-binding proteins [BR:dvi04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     6630774 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 AAA_7 AAA_22 AAA_16 cobW SRPRB AAA_24 AAA_18 PduV-EutP ATPase_2 Motif Other DBs NCBI-GeneID:  6630774 NCBI-ProteinID:  XP_032294876 LinkDB All DBs Position 2:complement(4714267..4715684) Genome browser AA seq 205 aa AA seqDB search MSDHSKPLLKILVLGDCGVGKTSLMNRYVNKHFTNMYKASIGTDFFSKEVVVNNRMITMH FWDTAGQERFQTLGVAFYRGTDCCVLVYDVTSPKSFKNLNLWRDEFLIQTSPRDPDSFPF VVLGNKADLDEQNVPTRVALHWCKMNNMPFYEISAKNGSNVEQAFEEIAKMGLEAVEEQQ KVENDFEPAIVLEHDGPPQKICCCC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtccgatcactctaagccattgcttaagatcctagtcttgggagactgcggcgttggg aaaacctcactgatgaatcgctatgtaaacaaacactttacaaatatgtataaggcatcg attggaacagacttttttagcaaagaggttgttgttaacaatcgcatgatcacaatgcat ttttgggacacggctggccaggagcgcttccagacactaggcgtggccttctatcgcggc acggattgctgcgtgctcgtttacgatgttacatctccgaagtcattcaagaatttgaac ttgtggcgcgacgaattcttgatacagaccagtccgcgggatcccgatagttttcccttt gttgtgctcggcaataaagcagatctagatgaacaaaatgtaccgacccgggtcgctctg cattggtgtaaaatgaacaacatgcccttttatgagatctcggcaaaaaatggcagcaat gtggaacaagcgttcgaggaaatagcaaaaatgggattggaagcggtagaggagcaacag aaagtcgaaaacgattttgaacctgccatagtcctagagcacgatggtccgcctcagaaa atatgctgctgctgttaa

DBGET integrated database retrieval system