KEGG   Drosophila virilis: 6631343
Entry
6631343           CDS       T01066                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
dvi  Drosophila virilis
Pathway
dvi00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    6631343
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dvi00199]
    6631343
Enzymes [BR:dvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     6631343
Cytochrome P450 [BR:dvi00199]
 Cytochrome P450, animal type
  CYP306 family
   6631343
SSDB
Motif
Pfam: p450 META Collectrin Synaptobrevin
Other DBs
NCBI-GeneID: 6631343
NCBI-ProteinID: XP_002055780
FlyBase: FBgn0206689
UniProt: B4M2S7
LinkDB
Position
Unknown
AA seq 522 aa
MSENSTDKSVRMEIIVFGVLLGIIVIIVSLICHRRNARLFGRMPPGPWGLPLLGYLPFLD
RRAPHKSLQALAKRYGGIYQLSMGSVRTVVLSDAVLVREFLRHEELTARAPLYLTHGIMG
GYGIIGAGGDIWKYQRRQLIEWLKALGMTRKQCETRAQLEQRIGRGVDECVQSYETEAQE
AHVLDPRPALQHTLGNIINDLVFGETYERQDPNWLYLQQLQEEGVKLIGVSGMVNFLPWL
RHLPGNKRSIRFLLDGKAKTHQLYDRIVERCEKQLELQLEQQQQKQQQPLPPHSILEHFL
GERQPFSQLYCDEQLRHLLADLFGAGVDTALATLRWFLLYMAREQRCQKRLQAELLQLSE
TPTLAELEPIAYLRACLSEVQRIRSVVPLGIPHGVDETTIVGDYRLEKGSMILILQWAIH
MNPEVWPAPEKFRPERFLNASGEYAAPAQFIPFQTGKRMCPGDELARMMLTLFTGRILRR
FHVQLPAGEEGNVDMAGECGITLAPANYKLRFSKLEQLQKND
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagtgaaaatagcacggataagtccgttcgcatggagatcattgtgtttggggtgctg
ctgggcattatcgtaattatcgtctctttgatttgtcatcgtcggaatgcgcgtctgttt
ggtcgcatgccgcctggaccgtggggcctgccgctgctgggctatttaccgttcctggac
aggcgggcaccgcacaagtcgctgcaggctctggccaaacgctatggcggcatctatcag
ctgagcatgggctcggtgcgtacggtggtgctttctgatgcggtgctggtgcgcgagttc
ctgcgccacgaggagctaacggcgcgtgcaccgctctatttgacgcacggcatcatgggt
ggctacggcatcattggcgctggcggggacatctggaaataccagcgtcgccagcttatc
gagtggcttaaggcgctgggcatgacgcgcaaacagtgcgagacgcgtgcacagctggag
cagcgcatcggtcgcggcgtcgacgagtgcgtccagtcgtacgagacggaagcgcaggaa
gcccatgtgctggacccgcgacccgcgctgcagcacacgctgggcaacatcatcaacgat
ctggtctttggtgaaacctacgagcgccaagatcccaactggctgtatctgcagcagctg
caggaggagggcgtcaagctgatcggtgtctcgggcatggtcaactttttgccctggctg
cgccatttgccgggcaacaaacgcagcattcgctttctgctggacggcaaggccaagacc
catcagctttacgatcgcattgtagagcgctgcgagaagcagctggagctgcagctggag
cagcagcagcaaaagcagcagcagccgctgccgccgcacagcatcctggagcattttctg
ggcgaacgccagccattctcgcagctctattgcgatgagcagctgcgtcatctgctggcc
gatctcttcggcgccggcgtcgatacagcgctggccacactacgctggttcctgctctat
atggcgcgcgagcagcgctgccagaagcgtctacaggcggaactgctgcagctcagtgaa
acgcccacgctggccgagctcgaaccgatcgcgtatctgcgcgcatgcctgtccgaggtg
cagcgcatcaggtctgtggtgccgctgggcataccgcacggcgtcgatgagaccacaatt
gtgggcgactatcgcttggagaagggcagcatgatactcatactgcagtgggccatacac
atgaatccggaggtctggccggcgcccgagaagtttcgtccggagcgctttctcaatgcc
agcggcgagtacgcggcgccggcacagttcatacccttccagacgggcaagcgcatgtgt
cctggcgatgagcttgctcgcatgatgctcaccctcttcaccgggcgcattctacggcgt
tttcacgtccagctacccgccggcgaggagggcaacgtggacatggccggcgagtgcggc
atcactttggcgccggcgaactacaagctgcgcttcagcaaattggagcagctgcagaaa
aacgattag

DBGET integrated database retrieval system