Drosophila virilis: 6631442 Help Entry 6631442           CDS       T01066                                  Symbol RPA3 Name (RefSeq) uncharacterized protein RPA3   KO K10740   replication factor A3 Organism dvi  Drosophila virilis Pathway dvi03030   DNA replication dvi03420   Nucleotide excision repair dvi03430   Mismatch repair dvi03440   Homologous recombination dvi03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:dvi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     6631442 (RPA3)    03420 Nucleotide excision repair     6631442 (RPA3)    03430 Mismatch repair     6631442 (RPA3)    03440 Homologous recombination     6631442 (RPA3)    03460 Fanconi anemia pathway     6631442 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:dvi03032]     6631442 (RPA3)    03400 DNA repair and recombination proteins [BR:dvi03400]     6631442 (RPA3) DNA replication proteins [BR:dvi03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     6631442 (RPA3) DNA repair and recombination proteins [BR:dvi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      6631442 (RPA3)    MMR (mismatch excision repair)      6631442 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      6631442 (RPA3) SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 DUF5666 Motif Other DBs NCBI-GeneID:  6631442 NCBI-ProteinID:  XP_002055680 UniProt:  B4M2H7 LinkDB All DBs Position X:complement(19864464..19865097) Genome browser AA seq 113 aa AA seqDB search MNVPFEPRTLVNGGMLKQFAGQTVSIMVRVESVAGTTLMGLSTDNQKLRISLPSELGAAQ GAWVEVIGIPNAGDAIRAKEVIEFGGDNIDFDTDSYNAMTQLLNNVKQFYRHG NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaatgttccctttgagccccgtactctggttaatggcggcatgctgaaacagtttgcc ggccaaaccgtcagcatcatggtgcgcgtggagagcgttgccgggacaacgctaatgggc ctcagcacggataaccagaagctgcgcattagcctacccagcgagctaggcgctgcccag ggcgcctgggtggaggttataggcattccaaatgctggcgacgccatacgcgccaaagag gttattgaatttggcggcgacaacattgactttgacacggatagctacaacgcgatgacc cagttgctgaacaatgtgaagcagttctatcgccatggctaa

DBGET integrated database retrieval system