Drosophila virilis: 6636218 Help Entry 6636218           CDS       T01066                                  Symbol Arf4 Name (RefSeq) ADP ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism dvi  Drosophila virilis Pathway dvi04144   Endocytosis Brite KEGG Orthology (KO) [BR:dvi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6636218 (Arf4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dvi04131]     6636218 (Arf4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dvi04147]     6636218 (Arf4)    04031 GTP-binding proteins [BR:dvi04031]     6636218 (Arf4) Membrane trafficking [BR:dvi04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     6636218 (Arf4) Exosome [BR:dvi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6636218 (Arf4)   Exosomal proteins of other body fluids (saliva and urine)    6636218 (Arf4)   Exosomal proteins of colorectal cancer cells    6636218 (Arf4) GTP-binding proteins [BR:dvi04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     6636218 (Arf4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU RXYLT1_N FLAD1_M cobW CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  6636218 NCBI-ProteinID:  XP_002059719 UniProt:  B4MF16 LinkDB All DBs Position 6:complement(1207319..1208429) Genome browser AA seq 180 aa AA seqDB search MGLTISSLLTRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRITEAEKELQNMLQEDELRDAV LLVFANKQDLPNAMSAAELTDKLHLNQLRNRHWFIQSTCATQGHGLYEGLDWLSAELAKK NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggattgacaatatctagtttactaacgcgactatttggcaaaaaacaaatgcgcatt ctaatggttggcctggacgctgccggaaagacaaccattctgtacaaattgaagctgggc gaaatcgtaacgaccattccaacaatcggatttaatgtggaaaccgtggagtacaaaaat atatgtttcaccgtttgggatgtcggcggccaggacaaaattcggccgctctggcgtcac tatttccaaaatacacaaggccttatttttgtcgtcgactcgaacgatcgcgatcggata accgaggccgaaaaagaactccaaaacatgcttcaagaagatgagctaagggatgccgtg ctcttagtttttgccaacaaacaggatctaccgaacgctatgagtgctgccgaactaact gacaagttgcacctgaatcaattgagaaaccgccactggtttattcagtcgacttgcgca acccagggacacggtttatatgagggactagattggctgtcagctgaattggccaaaaaa tga

DBGET integrated database retrieval system