Nitratidesulfovibrio vulgaris Miyazaki F: DvMF_2902
Help
Entry
DvMF_2902 CDS
T00816
Name
(GenBank) Porphobilinogen synthase
KO
K01698
porphobilinogen synthase [EC:
4.2.1.24
]
Organism
dvm
Nitratidesulfovibrio vulgaris Miyazaki F
Pathway
dvm00860
Porphyrin metabolism
dvm01100
Metabolic pathways
dvm01110
Biosynthesis of secondary metabolites
dvm01120
Microbial metabolism in diverse environments
dvm01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
dvm00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00860 Porphyrin metabolism
DvMF_2902
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
dvm04147
]
DvMF_2902
Enzymes [BR:
dvm01000
]
4. Lyases
4.2 Carbon-oxygen lyases
4.2.1 Hydro-lyases
4.2.1.24 porphobilinogen synthase
DvMF_2902
Exosome [BR:
dvm04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
DvMF_2902
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ALAD
Ribonuclease_T2
Motif
Other DBs
NCBI-ProteinID:
ACL09839
UniProt:
B8DS84
LinkDB
All DBs
Position
complement(3662489..3663490)
Genome browser
AA seq
333 aa
AA seq
DB search
MSEFGDFFRGRRLRRTAALREIVRETALHAADLMMAYFVVETDDPTFRKEIGAMPGQYQL
SLQELEKQVEAAVATGLRSCILFGIPREKDYRGSEAYNKDGIVQQAVRLLKKRWPNLVVC
TDVCLCEYTDHGHCGLVRQGDTSGEVHNDPTLSLLAKTAISHAEAGADIVAPSDMMDGRV
QAIRRALDQNGFSHIPVMSYAVKYASSFYGPFREAAESTPQFGDRKTYQMDPANRVEAMR
EAAADIAEGADMLIVKPAGPYLDIIRDVRDRFDVPVAAYQVSGEYSMIRAAGLNGWINED
AVVMESLLGIKRAGAGLIITYFTEDLLRKGLVK
NT seq
1002 nt
NT seq
+upstream
nt +downstream
nt
atgtccgaattcggggacttcttccgggggcgcagactgcgccgcaccgccgccctgcgt
gaaatcgtgcgcgaaaccgcgctgcacgcggccgacctgatgatggcctatttcgtggtg
gaaaccgacgaccccaccttccgcaaggaaatcggggccatgcccggccagtaccagctt
tcgttgcaggaactggaaaagcaggtggaagccgccgtggccacgggcctgcgcagttgc
atcctgttcggcatccccagggaaaaggactatcgcggcagcgaggcctacaacaaggac
ggcatcgtccagcaggccgtgcgcctgctgaagaagcgctggccgaaccttgtggtgtgc
accgacgtgtgcctgtgcgaatacaccgaccacggccactgcggcctggtgcgccagggc
gatacgtccggcgaggtgcacaacgaccccaccctgtcgctgctggccaagaccgccatc
agccatgccgaggcaggcgcggacatcgtggccccctcggacatgatggacggtcgggta
caggccatccgccgggcgctggaccagaacgggttcagccacatccccgtcatgtcctac
gcggtgaagtacgcatcgagcttctacggcccgttccgcgaggcagcggaatccaccccc
cagttcggcgaccgcaagacctaccagatggaccccgccaaccgggtggaagccatgcgc
gaggcggcggcggacatcgccgagggcgcggacatgctcatcgtcaagcccgccgggccg
tacctggacatcatccgcgacgtgcgcgaccgcttcgacgtgcccgtggccgcctatcag
gtgagcggcgaatactccatgatccgcgccgccggcctgaacggctggatcaacgaggac
gccgtggtcatggaatcgctgctgggcatcaagcgcgccggggccgggctgatcatcacg
tactttaccgaagacctgctgcgcaaagggctggtgaaatag
DBGET
integrated database retrieval system