Defluviicoccus vanus: HQ394_00730 Help Entry HQ394_00730       CDS       T06814                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dvn  Defluviicoccus vanus Pathway dvn01100   Metabolic pathways dvn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HQ394_00730    00074 Mycolic acid biosynthesis     HQ394_00730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HQ394_00730 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNT68156 UniProt:  A0A7H1MXH0 LinkDB All DBs Position complement(158803..159075) Genome browser AA seq 90 aa AA seqDB search MSGLTPFELEVARLIVQALELEDVAPEDIDPDAPLFGEGLGLDSLDALEIALAVSKTYGF QLRSDDADNTRIFASLRSLSAHIGENRTKG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtctaacgccgtttgaattggaagttgcgaggttgattgtccaggcgctggag ttggaggacgtggctccggaggatattgatcctgacgctcctctatttggcgaaggcctt ggattggattccctcgatgccctggaaatagccctggcggtctccaagacctacggcttt cagttgcgctccgacgatgccgataatacccggatctttgcatcgttgcggtcgctaagc gcacatatcggagagaaccgcaccaaggggtga

DBGET integrated database retrieval system