Defluviicoccus vanus: HQ394_11025 Help Entry HQ394_11025       CDS       T06814                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dvn  Defluviicoccus vanus Pathway dvn01100   Metabolic pathways dvn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HQ394_11025    00074 Mycolic acid biosynthesis     HQ394_11025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HQ394_11025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CorC_HlyC Motif Other DBs NCBI-ProteinID:  QNT69752 UniProt:  A0A7H1N216 LinkDB All DBs Position 2406389..2406514 Genome browser AA seq 41 aa AA seqDB search MMNLTMEVEDHFNVDIPINALAEVNTIGDLVTLLMQRTGGS NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgatgaatctgacgatggaagtggaagatcacttcaacgtcgacatccctattaatgca cttgcggaagtaaacaccatcggtgatttagtcaccctgctcatgcagaggacaggcggt agttga

DBGET integrated database retrieval system