Defluviicoccus vanus: HQ394_18180 Help Entry HQ394_18180       CDS       T06814                                  Name (GenBank) hypothetical protein   KO K04078   chaperonin GroES Organism dvn  Defluviicoccus vanus Brite KEGG Orthology (KO) [BR:dvn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dvn03110]     HQ394_18180    03029 Mitochondrial biogenesis [BR:dvn03029]     HQ394_18180 Chaperones and folding catalysts [BR:dvn03110]  Heat shock proteins   HSP10    HQ394_18180 Mitochondrial biogenesis [BR:dvn03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     HQ394_18180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QNT70889 UniProt:  A0A7H1N5A3 LinkDB All DBs Position 3944578..3944751 Genome browser AA seq 57 aa AA seqDB search MVAVGQGARGEDGERIPLEVRTGDPVLFGKWSGSEVKIDGREFLITIEPDLFGIIEG NT seq 174 nt NT seq  +upstreamnt  +downstreamnt gtggtcgccgtcggccaaggagcgcgtggcgaggacggcgaacgcattccactcgaggtc aggactggcgaccccgtgctgttcggcaaatggtcgggcagcgaggtcaagatcgacggg cgagagttcctcatcacgatagaacccgatcttttcgggattatcgagggttaa

DBGET integrated database retrieval system