Desulfosarcina variabilis: Dvar_11310 Help Entry Dvar_11310        CDS       T10869                                  Name (GenBank) AcpP: acyl carrier protein   KO K02078   acyl carrier protein Organism dvr  Desulfosarcina variabilis Pathway dvr01100   Metabolic pathways dvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dvar_11310    00074 Mycolic acid biosynthesis     Dvar_11310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dvar_11310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  XPS83113 LinkDB All DBs Position complement(1287875..1288102) Genome browser AA seq 75 aa AA seqDB search MSVEDKVKKIIAEKLSVDISEVVPEASFVDDLGADSLDLVELIMSMEEEFDVDISDEDAE KMVTVKDAFDYIKEH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtctgtagaagataaagtcaaaaaaatcatcgctgagaaactgagtgtcgatatttcc gaggtggttccggaagcatcttttgtcgatgatctcggcgccgacagcctcgacctggtg gagctgatcatgtccatggaagaggagttcgacgtggatatttcagacgaagacgctgaa aaaatggtcaccgtcaaagatgcctttgattacatcaaggaacattaa

DBGET integrated database retrieval system