Desulfosarcina variabilis: Dvar_11700 Help Entry Dvar_11700        CDS       T10869                                  Name (GenBank) acyl carrier family protein   KO K02078   acyl carrier protein Organism dvr  Desulfosarcina variabilis Pathway dvr01100   Metabolic pathways dvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Dvar_11700    00074 Mycolic acid biosynthesis     Dvar_11700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Dvar_11700 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding DUF7527 Motif Other DBs NCBI-ProteinID:  XPS83152 LinkDB All DBs Position 1322419..1322679 Genome browser AA seq 86 aa AA seqDB search MTKDEIEKKIIHIFEDQFEIQDPKTDDDLREVYEFDSIDAIELLREIELLLGVQLTRDEK KAAMDIRTIDDIVKYVMAMDKNHCKN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacaaaagatgagatagaaaagaaaatcatccatattttcgaagatcagttcgagatc caagatccgaaaacagacgatgatttgcgtgaagtgtacgagtttgacagtatcgatgcc atcgaactgctaagggaaatcgagcttctattaggggttcagctgacgcgcgacgagaaa aaggccgccatggatatccgtaccattgacgatatcgttaaatatgtgatggccatggac aaaaatcattgcaagaattga

DBGET integrated database retrieval system