Desulfosarcina widdelii: DSCW_15050
Help
Entry
DSCW_15050 CDS
T06303
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
KO
K07091
lipopolysaccharide export system permease protein
Organism
dwd
Desulfosarcina widdelii
Pathway
dwd02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
dwd00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
DSCW_15050 (lptF)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
dwd02000
]
DSCW_15050 (lptF)
Transporters [BR:
dwd02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
DSCW_15050 (lptF)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
DUF7619
Motif
Other DBs
NCBI-ProteinID:
BBO74088
UniProt:
A0A5K7YZN3
LinkDB
All DBs
Position
complement(1597039..1598172)
Genome browser
AA seq
377 aa
AA seq
DB search
MPPFFINLAFFSFIFLMKQILDITDMIVNHNVGLGAVCLLLIYTMPYFLQYIIPMSVMMA
VLMSLLRMSGDNEIIALKASGVSIYRLVPPVLIFSAMGTLAAGFMTVYGVPHGTFRFKTL
LLDVASTNLNVSLKERTFNDSFDNIMLYVNKIDPRSGELLNVFIEDRRKKGVSNTVIARR
GKIVGDPKTMLYHMRLFDGTINQMDIADSASHIVRFDTYDIRLDLKAAAASASVAKKSPK
EMTPKELARYIRKVKGKSKENYYGALLKLHKKFSIPFACIAMGLLAMPLGIQAKHSKKAF
GVGLGLFFFLLYYMLLSIGSAFGENGSYPPVIGMWMPNALLGGAGIFLLVRSAKEKPVTI
RWLESLWFSISALMSKR
NT seq
1134 nt
NT seq
+upstream
nt +downstream
nt
atgcccccttttttcatcaatctggcatttttctcttttatcttcctgatgaaacagatt
ctcgatattaccgacatgatcgtcaatcataatgtagggttgggggccgtctgcctgctg
ctgatctacacgatgccctatttcctccagtacatcattcccatgtccgtgatgatggcg
gttctgatgtccctgttgcggatgtccggcgacaacgaaattatcgccctgaaggccagc
ggcgtgagcatttaccggctggtgccgccggttctgatcttcagcgcgatgggaacgctg
gccgctgggtttatgaccgtctacggggtgccccacgggacctttcgattcaaaaccctg
ctgttggacgtggcgtcgaccaacctgaacgtcagcctgaaagagcgtaccttcaacgac
agtttcgacaacatcatgctctatgtgaacaagatcgacccccgcagtggagaactgctc
aatgtgtttattgaggaccggcgaaaaaaaggcgtcagcaatacggttattgcgcgtcgg
gggaagattgtcggcgatccgaaaacaatgctctaccatatgcgccttttcgacggaaca
atcaaccagatggatatcgccgacagcgcttcccatatcgtccgtttcgatacctatgat
atccggctggaccttaaggctgccgcggccagcgccagcgttgcgaaaaagagtcccaag
gagatgacgcccaaagaacttgcccgatatatccgtaaggttaaaggtaagagtaaagaa
aactattacggagctttgttgaaactgcataagaagttttccatcccgttcgcctgtatt
gctatgggactattggccatgcccctgggaatccaggcgaagcactcgaaaaaggctttc
ggggtcggactggggctgttcttttttcttctgtattatatgctgctgtccatcggttcg
gcctttggagaaaatggaagctatccgccggtgatcggtatgtggatgcccaacgccctt
ttaggaggcgccgggatcttcctgctggtccggtcggccaaagaaaaaccggtgacaatt
cgttggttggaatcgctctggttctccatctcagcgttgatgagtaaaagatga
DBGET
integrated database retrieval system