Desulfosarcina widdelii: DSCW_27770 Help Entry DSCW_27770        CDS       T06303                                  Symbol acpP-1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dwd  Desulfosarcina widdelii Pathway dwd01100   Metabolic pathways dwd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dwd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSCW_27770 (acpP-1)    00074 Mycolic acid biosynthesis     DSCW_27770 (acpP-1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSCW_27770 (acpP-1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding HisZ_C MAD7 Motif Other DBs NCBI-ProteinID:  BBO75360 UniProt:  A0A5K7Z3V6 LinkDB All DBs Position 2906662..2906928 Genome browser AA seq 88 aa AA seqDB search MQERINELRQKIVQALNLQDIAPEEIDPDEQLVGGRLGIDSIDVLEMVMMVEKDYGLTID NRELGARVFASVRALAAFIENPTAETPN NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaagaacggatcaacgaactgcggcaaaaaattgttcaggccctgaatctgcaggat atcgcaccggaggaaatcgacccggacgaacaactggtgggggggcgattgggcatcgac tccattgatgtactggaaatggtcatgatggtggaaaaggattacggactgaccatcgac aaccgtgaactgggcgcccgggtgttcgcttcggtacgggcgctggccgctttcatcgaa aatccaaccgccgagaccccgaattag

DBGET integrated database retrieval system