Desulfosarcina widdelii: DSCW_61410 Help Entry DSCW_61410        CDS       T06303                                  Name (GenBank) hypothetical protein   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism dwd  Desulfosarcina widdelii Pathway dwd00260   Glycine, serine and threonine metabolism dwd01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:dwd00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     DSCW_61410 Enzymes [BR:dwd01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      DSCW_61410     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      DSCW_61410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD DUF7577 Lar_restr_allev Motif Other DBs NCBI-ProteinID:  BBO78724 UniProt:  A0A5K7ZKE7 LinkDB All DBs Position complement(6629173..6629433) Genome browser AA seq 86 aa AA seqDB search MALTLTCPICGKRNGYEFRYGGEDKGPRPAEEGLTPAAWCEYVHMNKCTAGVQKEWWFHR DGCGSWFTTWRDTTKNIEVKQPEASK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggccttaacactcacctgccccatctgcggcaaacgcaacggttacgaattccgttac ggaggagaagacaaggggccgcgcccggccgaggaaggcctgacaccggcggcctggtgc gaatatgtccatatgaacaagtgcacggccggcgtccagaaggagtggtggtttcaccgc gacggttgcggatcatggtttaccacctggcgcgacacaaccaaaaacatcgaagtgaaa caaccggaggcgagcaaatga

DBGET integrated database retrieval system