Drosophila willistoni: 6640567 Help Entry 6640567           CDS       T01067                                  Name (RefSeq) calmodulin-beta   KO K02183   calmodulin Organism dwi  Drosophila willistoni Pathway dwi04070   Phosphatidylinositol signaling system dwi04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dwi00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6640567  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6640567  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dwi01009]     6640567   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dwi04131]     6640567    03036 Chromosome and associated proteins [BR:dwi03036]     6640567   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dwi04147]     6640567 Protein phosphatases and associated proteins [BR:dwi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6640567 Membrane trafficking [BR:dwi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6640567 Chromosome and associated proteins [BR:dwi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6640567 Exosome [BR:dwi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6640567 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 CFAP251_C EF-hand_5 AIF-1 EF-hand_FSTL1 EF_EFCAB10_C EH EF-hand_EFHB_C DUF5580_M SPARC_Ca_bdg SurA_N_3 SAPC2_N Phage_TAC_12 DUF2458 Motif Other DBs NCBI-GeneID:  6640567 NCBI-ProteinID:  XP_002063560 UniProt:  B4MR07 LinkDB All DBs Position 2L Genome browser AA seq 148 aa AA seqDB search MEELRPDEMIWITEAFRILQKDSEGSVTTRELATVMRSLGCHPSEGELQSMINEVDYDGN GSIEIEEFTAMILRKLRATNNEDELREAFRIYDRDNNGFIHPGELKYVLTALGVKISDEE VDEMIREYDYDHDGQMNFDDFVGMMSTI NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggaggaactacgacccgatgaaatgatttggatcaccgaagcctttcgaatacttcag aaggatagtgagggaagtgtcactacacgtgaattggcaactgtgatgcgttccttgggc tgtcatcccagtgagggtgaacttcagtctatgatcaatgaggtggattacgatggtaat ggttccattgaaattgaagaattcactgccatgattttgaggaaattgcgtgccaccaac aatgaggatgaactacgtgaagcatttcgtatctatgatagagataacaatggtttcatt cacccaggcgaattgaaatacgtattgacggcattgggtgtgaaaattagcgatgaagaa gttgatgaaatgattagagaatatgattacgatcatgatggacaaatgaatttcgatgat tttgttggcatgatgtcaacgatttaa

DBGET integrated database retrieval system