Drosophila willistoni: 6643442 Help Entry 6643442           CDS       T01067                                  Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism dwi  Drosophila willistoni Pathway dwi04070   Phosphatidylinositol signaling system dwi04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:dwi00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     6643442  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     6643442  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dwi01009]     6643442   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dwi04131]     6643442    03036 Chromosome and associated proteins [BR:dwi03036]     6643442   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dwi04147]     6643442 Protein phosphatases and associated proteins [BR:dwi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      6643442 Membrane trafficking [BR:dwi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     6643442 Chromosome and associated proteins [BR:dwi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      6643442 Exosome [BR:dwi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    6643442 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 Dockerin_1 EFhand_Ca_insen DUF1103 Caleosin TerB FCaBP_EF-hand DUF5580_M SPEF2_C MotA_activ Fe_hyd_lg_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  6643442 NCBI-ProteinID:  XP_002066102 UniProt:  B4MY99 LinkDB All DBs Position 2L Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVTMMTSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgacagaggaacaaatcgccgaattcaaagaggcattctcgctattc gacaaagacggcgatggcaccatcacaacaaaggaattgggaacagtcatgcgctccctg ggacagaaccccacagaggctgagctgcaggacatgataaacgaggtcgatgccgacggc aacggtacaattgacttcccagaattccttacaatgatggcacgcaaaatgaaggacacc gatagcgaagaagagatccgagaagccttcagagttttcgataaggatggcaacggcttc atctcagcggccgaattgcgtcatgtgatgacaaatttgggcgagaaattaacagacgag gaggtcgatgagatgatccgtgaggctgatatcgatggtgatggtcaggtcaattacgaa gaattcgtgactatgatgacatcgaagtga

DBGET integrated database retrieval system