Drosophila willistoni: 6649426 Help Entry 6649426           CDS       T01067                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism dwi  Drosophila willistoni Pathway dwi04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:dwi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     6649426  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dwi04121]     6649426    03400 DNA repair and recombination proteins [BR:dwi03400]     6649426 Ubiquitin system [BR:dwi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      6649426    Cul5 complex      6649426 DNA repair and recombination proteins [BR:dwi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      6649426 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  6649426 NCBI-ProteinID:  XP_002072193 UniProt:  B4NFW2 LinkDB All DBs Position 3R:31601793..31603927 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPIDQRLYNQDNDIMEDESTLQD YGVTVSTAKAQAPAQLGLTFRNDMGDFETLDMSPYSAPPDLPEVMKNQEASNGQEQVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcctaatgatccgaaggcaaaagacaaccatcttcacagatgcgaaggaa aacacaacagttgccgaactgaaacgtatgattgaaggtatactaaaagtacagcccatc gatcagcggttatacaatcaggacaatgacatcatggaggatgagagcacgctgcaggat tatggcgttacagtgtcaacggcaaaagctcaggctccagcgcaactgggcttgaccttc agaaacgacatgggtgactttgagacactggatatgtcaccgtactcagcaccaccagat ttacctgaagttatgaaaaaccaagaggcctccaatggacaggaacaagttgcatag

DBGET integrated database retrieval system