Drosophila yakuba: Dyak_GE12086 Help Entry Dyak_GE12086      CDS       T01068                                  Name (GenBank) uncharacterized protein   KO K10419   dynein light chain roadblock-type Organism dya  Drosophila yakuba Pathway dya04814   Motor proteins Brite KEGG Orthology (KO) [BR:dya00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     Dyak_GE12086  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dya04131]     Dyak_GE12086   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:dya03037]     Dyak_GE12086    04812 Cytoskeleton proteins [BR:dya04812]     Dyak_GE12086 Membrane trafficking [BR:dya04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     Dyak_GE12086 Cilium and associated proteins [BR:dya03037]  Motile cilia and associated proteins   Dynein arm    Dyak_GE12086 Cytoskeleton proteins [BR:dya04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Dyak_GE12086 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Robl_LC7 LAMTOR5 DUF900 Motif Other DBs NCBI-ProteinID:  EDW91445 UniProt:  B4PAQ4 LinkDB All DBs Position 2R Genome browser AA seq 114 aa AA seqDB search MQDAETDTKRTKSYVEDVFRKVQAKPGVEDILIMNHSGVPVKTSMDRQDGLQYACLYDNL REKCQAFLSKMEPAQNLTLLRVRTKFHEVLITPDAKITVLVVQNAKDTFLNIKG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcaggatgcagagacagatacgaagcgaaccaaaagctacgtggaggacgtatttcgc aaagtgcaggcgaaacccggcgtggaggacatattgatcatgaatcactcgggtgtgccg gttaagacctcgatggatcgccaggatggcctgcagtacgcctgtctatatgacaatttg cgggagaagtgccaggcattcctctctaaaatggagccagctcaaaatttaactctattg agagtgcgtaccaagtttcacgaggtactgattacaccagatgccaagatcaccgttttg gtggttcagaatgccaaggatacgtttcttaacattaagggttag

DBGET integrated database retrieval system