Drosophila yakuba: Dyak_GE13140 Help Entry Dyak_GE13140      CDS       T01068                                  Name (GenBank) uncharacterized protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism dya  Drosophila yakuba Pathway dya03020   RNA polymerase dya03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:dya00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     Dyak_GE13140   09124 Replication and repair    03420 Nucleotide excision repair     Dyak_GE13140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:dya03021]     Dyak_GE13140    03400 DNA repair and recombination proteins [BR:dya03400]     Dyak_GE13140 Transcription machinery [BR:dya03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      Dyak_GE13140 DNA repair and recombination proteins [BR:dya03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       Dyak_GE13140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L SHNi-TPR Motif Other DBs NCBI-ProteinID:  EDW90184 UniProt:  B4P8S6 LinkDB All DBs Position 2R Genome browser AA seq 117 aa AA seqDB search MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAG YKVPHPLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEGGD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaacgcacctccgaccttcgagtcatttctgctctatgagggcgagaaaaaaataatc aaggaattggacaccaaagtgaccaatgcggctatattcaccataaacaaagaggatcac actctgggaaacatgatccgcaaccaactgctgaaggaccccaatgtcttgtttgccggc tacaaggttccccatcctttggagcacaagttcgttatccgcatccagactacggccgat tactctccgcaagaagccttcatgaatgccataaccgatcttctagcagaattatccctc ttcgaagagcgtttcaaagacgccatcaaggagaagaaggagggcggcgattaa

DBGET integrated database retrieval system