Drosophila yakuba: Dyak_GE28233 Help Entry Dyak_GE28233      CDS       T01068                                  Name (GenBank) uncharacterized protein   KO K03094   S-phase kinase-associated protein 1 Organism dya  Drosophila yakuba Pathway dya03083   Polycomb repressive complex dya04120   Ubiquitin mediated proteolysis dya04141   Protein processing in endoplasmic reticulum dya04310   Wnt signaling pathway dya04341   Hedgehog signaling pathway - fly dya04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dya00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Dyak_GE28233    04120 Ubiquitin mediated proteolysis     Dyak_GE28233   09126 Chromosome    03083 Polycomb repressive complex     Dyak_GE28233  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Dyak_GE28233    04341 Hedgehog signaling pathway - fly     Dyak_GE28233    04350 TGF-beta signaling pathway     Dyak_GE28233  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dya04131]     Dyak_GE28233    04121 Ubiquitin system [BR:dya04121]     Dyak_GE28233    03036 Chromosome and associated proteins [BR:dya03036]     Dyak_GE28233 Membrane trafficking [BR:dya04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     Dyak_GE28233 Ubiquitin system [BR:dya04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      Dyak_GE28233    Cul7 complex      Dyak_GE28233 Chromosome and associated proteins [BR:dya03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      Dyak_GE28233   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      Dyak_GE28233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-ProteinID:  KRK00488 UniProt:  A0A0R1DTK7 LinkDB All DBs Position 2R Genome browser AA seq 160 aa AA seqDB search MVRFETRDGRTIRVNLALLERSLVIREMCRVGQVPEDEDFILPLHGIHSDVLLKILLWAE YHEKHEEPAWVAKKDPLPAEEIELQTCDWDKEFLRVQIDSICDIMEGCNYLDIPWLYKLC AQKLVFHSRREPVAQFRKYLEKIPSLNEFQALFIEQIENL NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggtgcgattcgagacaagggatggcaggacgatccgagtgaatctcgctctgctcgag agatccttggtgatccgcgagatgtgccgcgttggccaggtaccagaggacgaggacttc atcctgccactgcacggaatacacagcgatgtcctgctgaagatcctgctgtgggcagag taccacgagaaacacgaggagcccgcctgggtggccaaaaaggatcctcttccggccgag gagattgagctacagacatgcgactgggacaaggagttccttcgcgtgcaaatcgatagc atttgcgacatcatggagggctgcaactacttggacattccttggctctacaagctctgt gcccagaaactcgtcttccacagcagacgcgagccagtggcgcagttcagaaagtacttg gagaagatcccatccttaaacgagttccaggccctcttcattgagcaaattgaaaattta tag

DBGET integrated database retrieval system