Drosophila yakuba: Dyak_GE28993 Help Entry Dyak_GE28993      CDS       T01068                                  Name (GenBank) uncharacterized protein   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism dya  Drosophila yakuba Pathway dya04081   Hormone signaling dya04082   Neuroactive ligand signaling Brite KEGG Orthology (KO) [BR:dya00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     Dyak_GE28993    04081 Hormone signaling     Dyak_GE28993  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dya04147]     Dyak_GE28993    04031 GTP-binding proteins [BR:dya04031]     Dyak_GE28993 Exosome [BR:dya04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    Dyak_GE28993   Exosomal proteins of colorectal cancer cells    Dyak_GE28993 GTP-binding proteins [BR:dya04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     Dyak_GE28993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma Elicitin Motif Other DBs NCBI-ProteinID:  KRK00072 UniProt:  A0A0R1DSA8 LinkDB All DBs Position 2R Genome browser AA seq 66 aa AA seqDB search MAANLQQQRSINLQLRREMEMERMPVSVACSLMMKYMLEHEEEDCLLSGFTQKVNPFREK SSCSIL NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggctgctaatttgcaacagcagcgctccatcaacttgcagctacggcgggaaatggag atggagcggatgcccgtctcggtggcctgctccttgatgatgaagtacatgctggagcac gaggaagaggactgtctactcagcggcttcactcagaaggtgaatccgtttcgcgaaaag agctcctgcagcatcctatag

DBGET integrated database retrieval system