Dyella sp. M7H15-1: EO087_01635 Help Entry EO087_01635       CDS       T05846                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism dye  Dyella sp. M7H15-1 Brite KEGG Orthology (KO) [BR:dye00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:dye03110]     EO087_01635 (grxC) Chaperones and folding catalysts [BR:dye03110]  Protein folding catalysts   Protein disulfide isomerase    EO087_01635 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_3 GST_N_2 Thioredoxin_3 Glrx-like GST_N DSBA Motif Other DBs NCBI-ProteinID:  QAU22846 UniProt:  A0A410UF32 LinkDB All DBs Position 317988..318251 Genome browser AA seq 87 aa AA seqDB search MPKIEVYSTAVCPYCVVTKNLLKAKGLSWEEVRVDTDLAQRDIMLARSGGRRSVPQIFIN NQHVGGYDDLVAADRSGKLAQWLGEVA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcccaagatcgaagtctattccaccgcagtatgcccctattgcgtggtgaccaagaac ctgctgaaggctaagggtctgagctgggaggaggtacgcgtggataccgatctggcgcag cgtgacatcatgcttgcgcgcagcggtggtcgccgcagtgtgccgcagatcttcatcaac aatcagcacgttggcgggtacgacgatttggtcgccgccgatcgcagtggcaagctggcg caatggctgggtgaagtggcatga

DBGET integrated database retrieval system