Dyella sp. M7H15-1: EO087_07695 Help Entry EO087_07695       CDS       T05846                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dye  Dyella sp. M7H15-1 Pathway dye01100   Metabolic pathways dye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EO087_07695    00074 Mycolic acid biosynthesis     EO087_07695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EO087_07695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  QAU23888 UniProt:  A0A410UI73 LinkDB All DBs Position complement(1638776..1639018) Genome browser AA seq 80 aa AA seqDB search MSTIEDRVKKIVVEQLGVEEDKVTPNASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKLTTVQDAMKYIEEHAKKK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagatcgcgtcaagaaaatcgtcgtcgagcaactgggcgtggaggag gataaggtcacaccgaacgcttcgttcgtggacgatctgggcgcagactcgctggacacg gtcgagctagtgatggcgcttgaagaggaattcgaaaccgaaattccggacgaggacgct gaaaagctcaccaccgtgcaggatgccatgaagtacatcgaggagcacgccaagaagaag tga

DBGET integrated database retrieval system