KEGG   Dyella sp. M7H15-1: EO087_08105
Entry
EO087_08105       CDS       T05846                                 
Name
(GenBank) phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
dye  Dyella sp. M7H15-1
Pathway
dye00260  Glycine, serine and threonine metabolism
dye00270  Cysteine and methionine metabolism
dye00680  Methane metabolism
dye01100  Metabolic pathways
dye01110  Biosynthesis of secondary metabolites
dye01120  Microbial metabolism in diverse environments
dye01200  Carbon metabolism
dye01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dye00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    EO087_08105
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EO087_08105
   00270 Cysteine and methionine metabolism
    EO087_08105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dye04147]
    EO087_08105
Enzymes [BR:dye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     EO087_08105
    1.1.1.399  2-oxoglutarate reductase
     EO087_08105
Exosome [BR:dye04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EO087_08105
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT_AHAS_ss NAD_binding_2 ACT KARI_N XdhC_C 3HCDH_N UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: QAU23957
LinkDB
Position
1723117..1724349
AA seq 410 aa
MKTSYPKQDIKVLLLEGVSRTAVETFQRAGYSQIEHHAKSLPEDELKARIADAYIIGIRS
RTPLTADVLKHAKRLIAVGCYCIGTNQVELGAAAKLGIPVFNAPYSNTRSVAELVIAETI
MLLRGIPRKNALCHRGGWTKSAAGSFEVRDKVLGIVGYGHIGTQVGVLAESLGMRVIFHD
IESKLSLGNARAAASLDDLLERADVVTLHVPEMPSTKLMMGKTELDKMKKGSLLINASRG
TVVDIDALAEMLHNEHVGGAAIDVFPMEPKGNDDAFVSPLIGMDNVILTPHIGGSTLEAQ
DNIGIEVASKLVRYSDNGSTLSAVNFPEVTLPEHPRSRRLLHIHRNVPGVLSRINELFSV
GNINIDAQFLQTSADVGYVVIDVSADAQQAASLKEKLATIPGTLRTRVLY
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaagacctcgtaccccaagcaagacatcaaggtgctgttactcgaaggcgtcagccgt
accgcggtggaaacctttcagcgcgccggctacagccagatcgagcaccacgccaaatcg
ctgcccgaggacgagttgaaagcgcgcattgccgacgcgtatatcatcggcatccgatcc
cgcacccctctcaccgccgacgtgctgaaacacgccaagcgtctgatcgccgtgggttgc
tattgcatcggcaccaatcaagtggaactgggtgcagcggccaagcttggcattccagtc
ttcaacgcgccctattccaacacccgcagcgtggcggagctggtgattgccgaaaccatc
atgctgctgcgtggcattccacggaagaacgcgctgtgccatcgcggcggctggaccaaa
tcggccgctggcagcttcgaggtgcgcgataaggtgctcggtatcgtcggttacggccat
atcggtacgcaggttggcgtccttgcggaaagcctcggcatgcgcgtgatcttccacgat
atcgaatccaaattgtcattgggcaatgcgcgcgccgcagccagtctggacgatctgctt
gagcgcgccgacgtcgtcacgctgcatgtgccggaaatgccctcgaccaaactgatgatg
ggcaagaccgaactcgacaagatgaagaagggctcgctgctcatcaatgcctcgcgcggc
accgtggtcgatatcgacgcgctcgccgagatgttgcacaacgaacatgtcggtggtgca
gccatcgacgtgttcccaatggaacccaaaggcaacgatgatgcgttcgtgtcgccactg
atcgggatggacaacgttatccttactccgcatatcggcggcagcacgctggaagcgcaa
gacaatatcggcattgaagtggccagcaagctggtgcgctacagcgacaacggctccacg
ctgtccgccgtcaatttcccggaagtcactttgcccgaacatccacgcagccgccgcctg
ttgcatatccatcgcaacgtgccaggcgtgctttcgcgcatcaacgaattgttctccgtc
ggcaatatcaacatcgatgcacagttcctgcagaccagtgcggacgtcggttacgtggtc
atcgatgtgtccgccgatgcgcagcaagctgcatcgctgaaggaaaagctggcgacgatt
ccgggaacgctgcgtacgcgcgtgctttattaa

DBGET integrated database retrieval system