Dyella sp. M7H15-1: EO087_10045 Help Entry EO087_10045       CDS       T05846                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism dye  Dyella sp. M7H15-1 Pathway dye02020   Two-component system dye02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:dye00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     EO087_10045  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     EO087_10045  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:dye02035]     EO087_10045 Bacterial motility proteins [BR:dye02035]  Flagellar system   Flagellar assembly proteins    Others     EO087_10045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QAU24289 UniProt:  A0A410UJ21 LinkDB All DBs Position complement(2149414..2149707) Genome browser AA seq 97 aa AA seqDB search MQITNIPNIAAIQNASVRSSETPVGMPVATPTAAQPEIRAGEDFATLQVAHDALRQAAPD FDVTRIAEIKAAMQSGAIRFDADKLSSLIMSIHGGKR NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcaccaacatccccaacatcgcagcaatccagaatgcttcggtcagatcgtcc gagacaccggttggcatgccggtggcgactccgaccgcagcgcagcctgagattcgcgcg ggcgaggatttcgccacgctgcaggtggcacacgatgccctgcgccaagccgcgccggac ttcgatgtgacccgcatcgccgagatcaaggcagccatgcaaagcggcgcgattcgtttc gacgccgacaaattgtccagtctgatcatgtctatccacggtggcaaaaggtaa

DBGET integrated database retrieval system