Dyella sp. M7H15-1: EO087_10480 Help Entry EO087_10480       CDS       T05846                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism dye  Dyella sp. M7H15-1 Brite KEGG Orthology (KO) [BR:dye00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dye03036]     EO087_10480 Chromosome and associated proteins [BR:dye03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     EO087_10480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB GAS TSC22 YabA Syntaxin CCDC22_CC bZIP_1 Mod_r Dynamitin DUF7491 DUF2203 Taxilin HAP1_N COG3_N SKA2 TMF_TATA_bd EMP24_GP25L Cluap1 CENP-H NRBF2 Nup88 TMF_DNA_bd DUF3450 SlyX APG6_N Motif Other DBs NCBI-ProteinID:  QAU25476 UniProt:  A0A410UMN2 LinkDB All DBs Position 2253554..2253778 Genome browser AA seq 74 aa AA seqDB search MKTPDSAQYELAALSQQLDRLLEHVHRLSEENRSLRHSQEQLASERAGLLSRNEQARSRV EAMIQRLKALENNG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaaacacccgattctgcccagtacgagcttgccgccctaagccagcagcttgatcgg ttgcttgagcacgtacatcggttaagcgaagagaatcgcagcctgcgccacagccaagaa caattggcaagcgaacgcgcaggcctgctgtcacgcaacgaacaggcgcgcagccgcgtt gaggccatgatccaacgactcaaggcgctcgagaacaatggctga

DBGET integrated database retrieval system