Dyella sp. GSA-30: DYGSA30_39270 Help Entry DYGSA30_39270     CDS       T10269                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dyg  Dyella sp. GSA-30 Pathway dyg01100   Metabolic pathways dyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DYGSA30_39270 (acpP_2)    00074 Mycolic acid biosynthesis     DYGSA30_39270 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DYGSA30_39270 (acpP_2) SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDU22470 LinkDB All DBs Position 4623550..4623819 Genome browser AA seq 89 aa AA seqDB search MSTIMATGISDEDILLRLKDVLRDTFEIDPARVTPDTHLFTDLELDSIDAVDLAIQVQDM TGMRIKPEDFKNVRTVSDVVATVRALLNR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcacgatcatggccaccggcatcagcgacgaagacatcctgctgcgtctcaaggat gtgttgcgcgataccttcgaaatcgacccggcgcgcgtcacacccgacacgcacctgttc accgacctggagctggacagcatcgacgctgtcgatctggcgatccaggtgcaggacatg accggcatgcgcatcaagcccgaggatttcaagaacgtacgtacggtcagcgacgtggtc gcgacggtgcgtgccctgctcaatcgctga

DBGET integrated database retrieval system