Dickeya zeae: W909_19095 Help Entry W909_19095        CDS       T03567                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism dzc  Dickeya zeae Pathway dzc00290   Valine, leucine and isoleucine biosynthesis dzc00650   Butanoate metabolism dzc00660   C5-Branched dibasic acid metabolism dzc00770   Pantothenate and CoA biosynthesis dzc01100   Metabolic pathways dzc01110   Biosynthesis of secondary metabolites dzc01210   2-Oxocarboxylic acid metabolism dzc01230   Biosynthesis of amino acids Module dzc_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine dzc_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:dzc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     W909_19095    00660 C5-Branched dibasic acid metabolism     W909_19095   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     W909_19095   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     W909_19095 Enzymes [BR:dzc01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      W909_19095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_4 ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  AJC68072 LinkDB All DBs Position complement(4248788..4249045) Genome browser AA seq 85 aa AA seqDB search MTHHQLSIQARYRPEVLERVLRVTRHRGFQVCAMNMTQGHNDDHVQIDMTVASHRSVDLL STQLSKLLDIACVEIQPLTSQQIRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacacatcatcagctttccattcaggctcgctatcgcccggaagttctggaacgcgta ttacgtgtgacccgtcaccgtggctttcaggtgtgcgccatgaacatgacgcagggtcac aatgacgatcacgtgcagatagacatgaccgttgccagccaccggtcagtggatttattg tcaacccaattaagcaaactgctggacatcgcctgtgtggagatccagccgctcacatca caacaaatacgtgcctga

DBGET integrated database retrieval system