Durio zibethinus (durian): 111281855 Help Entry 111281855         CDS       T05242                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dzi  Durio zibethinus (durian) Pathway dzi04145   Phagosome dzi04148   Efferocytosis dzi04620   Toll-like receptor signaling pathway dzi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dzi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111281855    04148 Efferocytosis     111281855  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111281855  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111281855  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111281855   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dzi04147]     111281855    04031 GTP-binding proteins [BR:dzi04031]     111281855 Membrane trafficking [BR:dzi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111281855  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111281855   Macropinocytosis    Ras GTPases     111281855  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111281855 Exosome [BR:dzi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111281855   Exosomal proteins of other body fluids (saliva and urine)    111281855   Exosomal proteins of colorectal cancer cells    111281855   Exosomal proteins of bladder cancer cells    111281855 GTP-binding proteins [BR:dzi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111281855 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  111281855 NCBI-ProteinID:  XP_022725321 UniProt:  A0A6P5XBW9 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFGANVAVDGNTVNLGLWD TAGQEDYTRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFLDHPGAVPITTAQGEELSKLIGAPVYIECSSKTQQNVKAVFDAAIKMVLQP PKQKKKKKKKRTAEKACSIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttccaggttcataaaatgcgtcacagtcggtgatggtgccgtcggcaagact tgcatgcttatctcctataccagcaatactttccctactgattatgtgccaactgtcttt gacaattttggtgcaaatgtggctgtggatgggaacactgttaatctgggattgtgggac actgctggccaggaagattacactagattaagacctttgagttatcgtggagcagacgtc ttcctgctggcattctctctcattagcaaagccagctatgaaaatgttgctaagaaatgg attcctgagttgaggcattatgcacccggtgttccgattattcttgtcggcactaagctt gatcttcgggatgataagcagttcttcctagatcaccctggtgcagtacccattaccaca gcccagggggaggaattgagcaagttaattggagcacccgtttacattgaatgtagttca aagacacagcagaatgtgaaagccgtctttgatgcggccatcaaaatggttctccagccg ccaaagcagaagaagaagaagaaaaagaagagaacggctgaaaaggcctgctcaatattg tga

DBGET integrated database retrieval system