Durio zibethinus (durian): 111293194 Help Entry 111293194         CDS       T05242                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism dzi  Durio zibethinus (durian) Pathway dzi03083   Polycomb repressive complex dzi04120   Ubiquitin mediated proteolysis dzi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111293194    04120 Ubiquitin mediated proteolysis     111293194   09126 Chromosome    03083 Polycomb repressive complex     111293194  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111293194    04121 Ubiquitin system [BR:dzi04121]     111293194    03036 Chromosome and associated proteins [BR:dzi03036]     111293194 Membrane trafficking [BR:dzi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111293194 Ubiquitin system [BR:dzi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111293194    Cul7 complex      111293194 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111293194   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111293194 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  111293194 NCBI-ProteinID:  XP_022741707 UniProt:  A0A6P5YN29 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MSSSGRKITLKSSDGESFEVDEAVAVESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEY CKKHVETPKTDDRAADDEIKSWDAEFVKVDQVTLFDLILAANYLNIEGLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcagggaggaagattactctgaagagctcggacggcgaatcgttcgaggtg gacgaagcggtggcggtggaatcgcaaacgattaagcacatgatcgaggatgattgcgcc gataacggaatacctttgcccaacgttacgagtaagatcctggccaaggtgatcgagtac tgcaaaaagcacgtcgagactcctaagactgacgatcgagcggccgatgatgaaattaaa agttgggacgctgagtttgtcaaggtcgatcaagtcactctctttgatctcattctggca gcaaactatttgaacatcgagggattgctggatcttacttgtcaaactgttgctgacatg atcaagggaaagacccctgaagagatcaggaagacttttaacatcaagaatgacttcacg cctgaggaggaggaagaggttcgtcgggagaaccagtgggcatttgaatga

DBGET integrated database retrieval system