Durio zibethinus (durian): 111296467 Help Entry 111296467         CDS       T05242                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism dzi  Durio zibethinus (durian) Brite KEGG Orthology (KO) [BR:dzi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:dzi03041]     111296467   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:dzi04052]     111296467 Spliceosome [BR:dzi03041]  Complex B   Other components    Complex B specific factors     111296467 Cytokines and neuropeptides [BR:dzi04052]  Neuropeptides   Unclassified    111296467 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Motif Other DBs NCBI-GeneID:  111296467 NCBI-ProteinID:  XP_022746520 UniProt:  A0A6P5Z1T3 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTVYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgttgaacgatcggctggggaagaaggtgcgcgtgaagtgcaacgac gacgacacgatcggagacctgaagaagctggtggcggctcaaacgggtacccgagccgac aagatccggatccagaagtggtatacggtttataaggatcatattaccctcaaagattac gagatccacgacggcatgggcctcgaactttactataattaa

DBGET integrated database retrieval system