Durio zibethinus (durian): 111302674 Help Entry 111302674         CDS       T05242                                  Name (RefSeq) late histone H2B.2.2-like   KO K11252   histone H2B Organism dzi  Durio zibethinus (durian) Brite KEGG Orthology (KO) [BR:dzi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:dzi03036]     111302674   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dzi04147]     111302674 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111302674 Exosome [BR:dzi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111302674 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PH_2 DUF1563 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  111302674 NCBI-ProteinID:  XP_022754204 UniProt:  A0A6P5ZN11 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MAREREAMYMTYVFRVLKQVHLGMAISSKAMSVINSLMNDMFAGKATKLSKYTERRTLSS REIQEAVKLVLPGELGKDAVAEGSKAVTNYASYIEKQFKLV NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcaagagaaagagaggcaatgtacatgacatacgtgttcagggtactaaagcaggtt catctaggaatggcaatttcttccaaggcaatgtcagtgatcaacagcttgatgaatgac atgttcgcaggtaaggcaaccaagctctccaagtacaccgaaagaaggacactgtcttca agggagattcaagaagcagtgaaattggttttgccaggagagcttggaaaagatgctgtt gcagaaggcagtaaagctgtcactaactatgcttcctacattgaaaaacagttcaaatta gtttga

DBGET integrated database retrieval system