Durio zibethinus (durian): 111303859 Help Entry 111303859         CDS       T05242                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism dzi  Durio zibethinus (durian) Pathway dzi04016   MAPK signaling pathway - plant dzi04070   Phosphatidylinositol signaling system dzi04075   Plant hormone signal transduction dzi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:dzi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     111303859    04070 Phosphatidylinositol signaling system     111303859    04075 Plant hormone signal transduction     111303859  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     111303859  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:dzi01009]     111303859   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111303859    03036 Chromosome and associated proteins [BR:dzi03036]     111303859   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dzi04147]     111303859 Protein phosphatases and associated proteins [BR:dzi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      111303859 Membrane trafficking [BR:dzi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     111303859 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      111303859 Exosome [BR:dzi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111303859 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  111303859 NCBI-ProteinID:  XP_022756067 UniProt:  A0A6P5XMD9 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagcttaccgacgaccagatctctgagttcaaggaggcctttagcctcttt gacaaggacggcgatggttgcattactaccaaggagcttgggactgtgatgcgatcactt gggcagaaccctacagaggcagaactccaagatatgattaatgaagttgatgctgatgga aatgggaccattgattttcctgaattccttaacctgatggcaaggaagatgaaggatact gactcagaggaggagcttaaagaggcattcagggtgtttgacaaggaccagaatggtttc atatccgcagctgagcttcgtcatgtgatgacaaatcttggtgagaagcttacagatgag gaagttgatgagatgatccgtgaagccgatgttgatggtgacgggcaaatcaactatgag gagttcgtcaaagtcatgatggccaaataa

DBGET integrated database retrieval system