Durio zibethinus (durian): 111306367 Help Entry 111306367         CDS       T05242                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism dzi  Durio zibethinus (durian) Pathway dzi03083   Polycomb repressive complex dzi04120   Ubiquitin mediated proteolysis dzi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111306367    04120 Ubiquitin mediated proteolysis     111306367   09126 Chromosome    03083 Polycomb repressive complex     111306367  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111306367    04121 Ubiquitin system [BR:dzi04121]     111306367    03036 Chromosome and associated proteins [BR:dzi03036]     111306367 Membrane trafficking [BR:dzi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111306367 Ubiquitin system [BR:dzi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111306367    Cul7 complex      111306367 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111306367   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111306367 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  111306367 NCBI-ProteinID:  XP_022759993 UniProt:  A0A6P6A4S5 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MKSRILKIKTSDNEISEVEEAVATMSKTIKIMAEGYSGGVIPLNNVHSTIFGRVIEWCKK HVDDGEDLEYYKGALKNWDAMFFEVDQAVLYHLLTAANYLDILSLCSIKDVKELFVYCNF LSFFLWFCVYFPILNYFQII NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgaaatctagaatcttgaagataaaaacttcagacaatgaaatatctgaggttgaggag gcggtggctaccatgtctaaaaccatcaaaatcatggctgaaggctactcaggtggggtg attccacttaacaacgttcacagcacaatctttggtagagtgattgagtggtgcaagaaa catgttgacgatggtgaagacttggagtactacaagggagcactcaagaattgggacgct atgttctttgaagttgatcaagccgttctttatcatcttctcacggctgcaaactacctt gatattttaagcctttgctccatcaaggatgtcaaagagctttttgtttactgtaacttt cttagtttttttctttggttttgtgtctacttccctattcttaactatttccaaataatt tga

DBGET integrated database retrieval system