Durio zibethinus (durian): 111308220 Help Entry 111308220         CDS       T05242                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism dzi  Durio zibethinus (durian) Pathway dzi03083   Polycomb repressive complex dzi04120   Ubiquitin mediated proteolysis dzi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111308220    04120 Ubiquitin mediated proteolysis     111308220   09126 Chromosome    03083 Polycomb repressive complex     111308220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111308220    04121 Ubiquitin system [BR:dzi04121]     111308220    03036 Chromosome and associated proteins [BR:dzi03036]     111308220 Membrane trafficking [BR:dzi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111308220 Ubiquitin system [BR:dzi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111308220    Cul7 complex      111308220 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111308220   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111308220 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  111308220 NCBI-ProteinID:  XP_022762269 UniProt:  A0A6P6ABJ3 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MASTSKKIMLKSSDGETFEVEEAVAVESQTIKHMIEDDCADNEIPLPNVNSKILSKVLEY CKKRVDAAADKEKNPDDELNAWNADFVKVDQKTLFDVILAANYLNIKSLLDLTCQTVADI IKGKTPEEIRKTFNIRNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcttcaacttcgaagaagataatgttgaagagctccgacggagagactttcgaggtg gaggaagcggtggcggttgaatcgcagacgatcaagcacatgatcgaagacgattgcgct gacaacgaaatccctctccctaacgtcaacagcaagatcttatccaaggttcttgagtac tgcaagaagcgcgtcgatgccgccgccgacaaggaaaagaaccccgatgatgaactcaat gcttggaatgctgattttgtcaaggttgaccaaaaaaccctctttgacgtcatcctggct gcgaactatttgaatatcaagagcttattggacttgacatgccaaaccgttgctgacatt atcaaggggaagacaccggaggagatccgcaagaccttcaacatcaggaatgatttcacc ccagaggaagaagaggaggttcggagggagaaccagtgggcattcgagtga

DBGET integrated database retrieval system