Durio zibethinus (durian): 111309548 Help Entry 111309548         CDS       T05242                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism dzi  Durio zibethinus (durian) Pathway dzi03083   Polycomb repressive complex dzi04120   Ubiquitin mediated proteolysis dzi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111309548    04120 Ubiquitin mediated proteolysis     111309548   09126 Chromosome    03083 Polycomb repressive complex     111309548  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111309548    04121 Ubiquitin system [BR:dzi04121]     111309548    03036 Chromosome and associated proteins [BR:dzi03036]     111309548 Membrane trafficking [BR:dzi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111309548 Ubiquitin system [BR:dzi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111309548    Cul7 complex      111309548 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111309548   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111309548 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Prefoldin_3 Motif Other DBs NCBI-GeneID:  111309548 NCBI-ProteinID:  XP_022764315 UniProt:  A0A6P6AHG3 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MSTSKVLTLMSKDNQIFEVEESVAMQSELIKNMIEDGCATGVIPLFRVHSKTLTMIIEWC GKHVDYVEANNVEDVEKEFNSWESEFLDVDRVSLNELFMAANYLNVEKLLKRVAKQVADM IKASKTVEEIRQTFGIKNDFTPQEEEEIRKQYSWIDD NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcaacatccaaggttttgacgctgatgagcaaagacaaccaaatcttcgaggttgaa gaatccgtagccatgcaatccgagctcatcaaaaacatgattgaagatgggtgcgccact ggtgtgattccattgttcagggtgcatagcaagaccttaacgatgataatcgaatggtgc ggaaaacatgtagattatgtggaagcaaacaacgttgaagacgtcgaaaaagaattcaac agttgggaatcggaatttcttgatgttgatagagttagtcttaacgagcttttcatggct gcaaactatctcaacgtagagaagttgctaaaacgagtggccaaacaagttgctgatatg atcaaagcaagcaaaactgttgaggaaattcgtcaaacttttggtatcaagaatgatttt actcctcaagaagaagaagaaattcgtaagcagtattcttggatcgacgattga

DBGET integrated database retrieval system