Durio zibethinus (durian): 111315292 Help Entry 111315292         CDS       T05242                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism dzi  Durio zibethinus (durian) Pathway dzi04145   Phagosome dzi04148   Efferocytosis dzi04620   Toll-like receptor signaling pathway dzi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:dzi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111315292    04148 Efferocytosis     111315292  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111315292  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111315292  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111315292   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dzi04147]     111315292    04031 GTP-binding proteins [BR:dzi04031]     111315292 Membrane trafficking [BR:dzi04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111315292  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111315292   Macropinocytosis    Ras GTPases     111315292  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111315292 Exosome [BR:dzi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111315292   Exosomal proteins of other body fluids (saliva and urine)    111315292   Exosomal proteins of colorectal cancer cells    111315292   Exosomal proteins of bladder cancer cells    111315292 GTP-binding proteins [BR:dzi04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111315292 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  111315292 NCBI-ProteinID:  XP_022772641 UniProt:  A0A6P6B6W7 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELKHYAPGVPIILVGTKI DLRDDQQFFVDHPGAVPISTAQGEELRKQIGSPAYIECSSKTQQNVKAVFDAAIKVVLQP PKKNKKKKKAAGGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcgagattcataaagtgcgtcaccgtcggcgatggcgctgtcggcaagacc tgcctgctgatttcctacaccagcaatactttccctacggactatgtcccgactgttttc gacaatttcagcgcaaatgttgtcgtggatggcagcactgtcaacttaggtttatgggat actgctggtcaggaggattacaatagattaagaccactgagctatcgtggggctgatgtc tttattcttgcattttctctcatcagcaaggccagttatgaaaacattgccaagaagtgg attcctgaattaaagcattatgcacctggtgttccgataattctggttggaactaagatt gatctccgggatgatcagcaattctttgtagaccatcctggtgcagtgcccatttctacg gctcagggagaggagttaaggaaacagatagggtctcctgcctacatcgagtgtagttca aaaacacagcagaatgtgaaggcagtctttgatgcagccattaaggtagtgctccagcct cctaagaaaaataagaagaagaaaaaggcggccggtggttgctcaatattatga

DBGET integrated database retrieval system