Durio zibethinus (durian): 111317263 Help Entry 111317263         CDS       T05242                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism dzi  Durio zibethinus (durian) Pathway dzi03083   Polycomb repressive complex dzi04120   Ubiquitin mediated proteolysis dzi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:dzi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111317263    04120 Ubiquitin mediated proteolysis     111317263   09126 Chromosome    03083 Polycomb repressive complex     111317263  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dzi04131]     111317263    04121 Ubiquitin system [BR:dzi04121]     111317263    03036 Chromosome and associated proteins [BR:dzi03036]     111317263 Membrane trafficking [BR:dzi04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     111317263 Ubiquitin system [BR:dzi04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      111317263    Cul7 complex      111317263 Chromosome and associated proteins [BR:dzi03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      111317263   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      111317263 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Methyltransf_16 Motif Other DBs NCBI-GeneID:  111317263 NCBI-ProteinID:  XP_022775451 UniProt:  A0A6P6BEA7 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MSLPERKITLMSSDGESFEIDEAVALESQTIKHMIEDNCADNGIPLPNVTSKILAKVIEY CKKHVEAPKTDDRAADDELKSWDADFVKVDQVTLFDLVLAANYLNIKDLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcgttgccggagaggaagattactctgatgagctcggatggcgaatcgttcgaaata gacgaagcggtggcgttggaatcgcagacgataaagcacatgatcgaggacaattgcgcg gataacggaataccgttgcccaatgttacgagtaagatcttggcgaaggtgatcgagtac tgcaaaaagcacgtggaggctcctaagaccgatgatcgagccgctgatgacgagcttaaa agttgggacgctgactttgtcaaggtcgatcaagtcactctcttcgatctcgttctggca gcaaactatttgaacatcaaggatttgttggatcttacttgtcaaaccgttgctgacatg atcaagggaaagaccccagaagagatcaggaagacttttaatatcaagaatgacttcacc cctgaggaggaggaggaggttcgtcgcgagaatcaatgggcatttgaatga

DBGET integrated database retrieval system