Duganella zoogloeoides: SR858_06200 Help Entry SR858_06200       CDS       T09628                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dzo  Duganella zoogloeoides Pathway dzo01100   Metabolic pathways dzo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dzo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SR858_06200    00074 Mycolic acid biosynthesis     SR858_06200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SR858_06200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD ACP_SdgA_C Ribosomal_L29 CDC13_N HH_AAEA_pHBA Motif Other DBs NCBI-ProteinID:  WQH05926 UniProt:  A0ABZ0Y1M6 LinkDB All DBs Position 1414281..1414547 Genome browser AA seq 88 aa AA seqDB search MIDLNAMSKEQLQQWVIDLLAEMFELDKAQLTADSNLYSDLDIDSIDAVDLAVKLKQLTG KRLQPEVFKTIRTIGDVVDALAGMTEPA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgattgatttgaacgcgatgagcaaagagcagctgcagcagtgggtcatcgatctgctg gccgagatgttcgagttggacaaggcgcagcttaccgccgattccaatctgtattccgat ctcgatatcgacagcatcgacgcggtggacctggccgtcaagctcaagcagctgaccggc aagcgcctgcaacccgaagtcttcaagaccatccgcaccatcggcgacgtcgtcgatgcg ctggccgggatgacggagcccgcgtaa

DBGET integrated database retrieval system