Duganella zoogloeoides: SR858_26335
Help
Entry
SR858_26335 CDS
T09628
Name
(GenBank) PLP-dependent aminotransferase family protein
Organism
dzo
Duganella zoogloeoides
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
GntR
HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID:
WQH04513
UniProt:
A0ABZ0XXM3
LinkDB
All DBs
Position
5990944..5992371
Genome browser
AA seq
475 aa
AA seq
DB search
MSQAKTIQEGHLTGWLPRLVENQGPRFLQIADALQAAVADGSLTPGDRLPPQRQLAARLD
VDLTTVTRAYDEARRRNLLEGRGARGTYVAAPKVELTSILDLSMNTPPPPAGVDFDDLLK
QGLSQVLMRADAELLMTYHLAGGSDSDRKAGATWLAPMFGHLDARQVIVCPGAQAAIAAS
ILALTAPGDIILAEPASYPGLLAAATRFGRRVIAVAADQHGMVPGMLEQACRQHQPALVY
LNPTLQNPTAITMPKHRRQELAGIARRCKVRIVEDDPYWLLADAPPPPVATFAPEQVVYI
STLSKCLTPGLRVAFVLIRESQERERFLDALRSFALMTAPLTAALATQWILDGSASRLME
GVRNEARLRHRMARTILAGRYSGTGDGLHVWLELPAYWNSAQLARAARSEGIAVTPAQAF
ATGTESVNAIRISLGSIKDRGRLQAGLQRLSHLLAQRSITPESASSPGTDTTSPP
NT seq
1428 nt
NT seq
+upstream
nt +downstream
nt
atgtcccaggcgaaaaccatacaagaaggacatttgactggctggttgccgcgcctggtc
gagaaccaggggccacggtttttgcagattgccgatgccttgcaggctgccgtggcagac
ggatcgctgacgcccggtgaccggttgcctccacagcgccagctggccgcccggctggac
gtggacctgacgacggtcacccgcgcctacgacgaagccaggcgccgcaacctgctggag
gggcgcggcgcccgcggcacgtatgtcgcagcgccgaaagtcgaactgacctcgatcctc
gacctcagcatgaacaccccgccaccgcccgctggcgtggacttcgacgacctgttgaaa
caaggtttgtcgcaagtgttgatgcgagccgatgcggaattgctgatgacctaccacctg
gccggcggcagcgactccgaccgcaaggcaggcgccacctggctcgcaccgatgttcgga
cacctggatgcccggcaagtgattgtctgcccgggggcgcaggcggcgatcgccgcatcg
atcctggcgctgacggcgcccggcgatatcatcctggccgagccggcgagctatcccggc
ttgcttgccgcagccacccggttcggccggagagtcattgcggtggccgcggaccagcac
gggatggtacccgggatgctcgagcaagcgtgccgccagcaccagcccgcgctggtgtac
ctcaaccccactttgcagaaccccactgccatcaccatgcccaagcaccggcgccaggag
cttgccggcatcgccaggcgctgcaaggtacgcatcgtcgaggacgatccctactggctg
cttgccgatgccccgccgccaccggttgccacgtttgcgccggaacaggtggtgtacatc
tcgaccctgtcgaaatgcctgacccccggcttgcgcgtcgcgttcgtgctcatacgcgag
tcccaggaacgcgagcgctttttggacgcactccgatcgtttgcgctgatgacagctccg
ctgacggccgcactggccacgcagtggatcctcgacggctcggccagcagattgatggaa
ggcgtacgcaacgaggcgcgcctgcgccaccgcatggcccgcactatcctggcggggcgg
tacagcggtaccggcgacggcctgcatgtctggctcgagttgccggcgtattggaactcc
gcgcagctggcgcgcgcagcccgcagcgagggcatcgccgtcacgccagcacaggcattt
gcaaccggcaccgaatccgtgaatgccatccggatttcgctgggcagcatcaaggaccgg
ggccgcttgcaggcaggcctgcaacggctgtctcacctgctggcgcagcgttcgatcact
ccggaatcggcttcgtcaccaggaacagatacgacatcgcccccatga
DBGET
integrated database retrieval system