Endosymbiont of Acanthamoeba sp. UWC8: I862_00285 Help Entry I862_00285        CDS       T03255                                  Name (GenBank) acylcarrier protein   KO K02078   acyl carrier protein Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa01100   Metabolic pathways eaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I862_00285    00074 Mycolic acid biosynthesis     I862_00285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I862_00285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AIF80622 UniProt:  A0A075MIG6 LinkDB All DBs Position complement(61989..62234) Genome browser AA seq 81 aa AA seqDB search MSDVESRVIKLVAEHLDVDASKVKPDARFSDDLGADSLDTVELVMAFEEEFNIEIPDNAA EKIIKVEDAVSFIKSQIDKAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgaaagccgcgttattaaattagttgccgagcatttagatgttgatgcg tctaaagtgaagccggatgcaaggtttagcgatgacctcggagcagatagcctggacacc gttgaactggttatggcatttgaagaagagttcaatatcgaaatacctgacaatgcagcg gaaaaaattattaaagttgaagatgcggttagttttataaaatcacaaattgataaagct tcttaa

DBGET integrated database retrieval system