Endosymbiont of Acanthamoeba sp. UWC8: I862_01735 Help Entry I862_01735        CDS       T03255                                  Name (GenBank) 50S ribosomal protein L28   KO K02902   large subunit ribosomal protein L28 Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa03010   Ribosome Brite KEGG Orthology (KO) [BR:eaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     I862_01735  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eaa03011]     I862_01735 Ribosome [BR:eaa03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     I862_01735   Bacteria     I862_01735 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L28 Motif Other DBs NCBI-ProteinID:  AIF80910 LinkDB All DBs Position 369196..369495 Genome browser AA seq 99 aa AA seqDB search MSRRCELNLEKAVMSGNNVSHSNRKTRRRFLPNIQTFSLLSDALGTFIRFDAAPSTIRSV EHNNGVDNYLLKASPSNLGKKAKALRKKIIEVLKAKQAG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctagaagatgcgagttaaatttagaaaaagcagtaatgagcggtaacaacgtttct cactcaaacagaaaaaccagaagaagatttctacccaatattcagactttttctttactc agcgatgcactcggtacttttattcgctttgatgctgctccaagcactatcagatctgtt gagcataacaacggtgttgataattatttgctcaaagccagcccttcaaacttaggcaaa aaagctaaagcgcttagaaaaaaaataattgaagttttaaaagctaagcaagccggctaa

DBGET integrated database retrieval system