Endosymbiont of Acanthamoeba sp. UWC8: I862_05000 Help Entry I862_05000        CDS       T03255                                  Symbol rpmF Name (GenBank) 50S ribosomal protein L32   KO K02911   large subunit ribosomal protein L32 Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa03010   Ribosome Brite KEGG Orthology (KO) [BR:eaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     I862_05000 (rpmF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eaa03011]     I862_05000 (rpmF) Ribosome [BR:eaa03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     I862_05000 (rpmF)   Bacteria     I862_05000 (rpmF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L32p Motif Other DBs NCBI-ProteinID:  AIF81556 UniProt:  A0A075MJE6 LinkDB All DBs Position complement(1041366..1041584) Genome browser AA seq 72 aa AA seqDB search MAVPKKKTSTSRRDKRRAHDALKPINVSFDKNTGEAKLPHHISLKDGMYNGKQILIKREK PTEDSASEAAEA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggcagtacctaagaagaagacttcgacgtcaagaagagataaaagacgagctcatgat gctttgaaaccgattaatgtttcttttgataaaaataccggtgaagcaaagcttccgcat catatttctttaaaagacgggatgtataacggcaagcaaatcttaattaaaagagaaaaa cctacggaagattcagcaagcgaagctgctgaggcataa

DBGET integrated database retrieval system