Endosymbiont of Acanthamoeba sp. UWC8: I862_05850 Help Entry I862_05850        CDS       T03255                                  Name (GenBank) 30S ribosomal protein S17   KO K02961   small subunit ribosomal protein S17 Organism eaa  Endosymbiont of Acanthamoeba sp. UWC8 Pathway eaa03010   Ribosome Brite KEGG Orthology (KO) [BR:eaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     I862_05850  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:eaa03011]     I862_05850 Ribosome [BR:eaa03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Small subunit     I862_05850   Bacteria     I862_05850   Archaea     I862_05850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S17 Motif Other DBs NCBI-ProteinID:  AIF81724 UniProt:  A0A075MQY8 LinkDB All DBs Position complement(1222688..1222930) Genome browser AA seq 80 aa AA seqDB search MPRKVLEGLVVSDKTDKTISVLVEKTYRHPLYHKIFKKSKKYAVHDPENSCAIGDRVEIV ESKPISKTKRWHLVKKIDAR NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcctagaaaagtattagaaggattggttgtaagtgataaaacggataaaactatatct gttttggtagagaaaacttataggcatcccctttaccacaaaatttttaagaaaagcaaa aaatatgctgtgcatgatcctgaaaattcatgcgccatcggtgaccgtgttgagattgtt gaaagtaaaccaatttctaaaactaaaagatggcaccttgtaaaaaaaatagatgctaga tag

DBGET integrated database retrieval system